« Back
Home /
Activin-B

Activin-B

Item no.	RLT-100-330
Manufacturer	ReliaTech
Amount	5ug
Category	Peptides & Proteins Recombinant Proteins
Type	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Human
Host	Insect Cells
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	INHBB, Inhibin beta-2, Activin beta-B
Available
NCBI Gene ID	3625
Uniprot	P06529
Biological Activity	The ED50 as determined by its ability to inhibit the proliferation of murine MPC-11 cells is = 2.0 ng/ml, corresponding to a specific activity of = 5 x 105 units/mg.
Description	Activin B is a TGF-ß family member that exhibits a wide range of biological activities including regulation of embryogenesis, osteogenesis, hematopoiesis, reproductive physiology and hormone secretion from the hypothalamic, pituitary and gonadal glands. Activin B, like certain other members of the TGF-ß family, signals through the ActRII receptor (Activin Receptor type II). Human Activin B is a 25.6 kDa disulfide-linked homodimer consisting of two ßB chains, each containing 115 amino acid residues.
Endotoxin Levels	< 0.1 ng/µg of protein (<1EU/µg)
Length [aa]	115
Molecular Weight	25.6 kDa
mRNA RefSeq	NM_002193.2
Protein RefSeq	NP_002184.2
Protein Sequence	GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Purity Confirmation	> 95% by SDS-PAGE & HPLC analyses
Synonyms	INHBB, Inhibin beta-2, Activin beta-B
Uniprot ID	P06529

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 5ug

available

Delivery expected until 9/20/2024

Express Delivery: Save 29 days

Compare

Add to wishlist

Recommend by mail