4-1BBL

Item no.	RLT-100-001
Manufacturer	ReliaTech
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Human
Host	E.coli
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	TNFSF9, CD137L, 4-1BB-L
Available
NCBI Gene ID	8744
Uniprot	P41273
Biological Activity	Determined by the dose-dependent stimulation of IL-8 production by human PBMC. The expected ED50 for this effect is 5-10 ng/ml. NOTE: Results may vary with different PBMC donors.
Description	4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL gene codes for a 254 amino acid type II transmembrane containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 205 amino acid extracellular domain. The soluble form of 4-1BBL contains the TNF-like portion of the extracellular domain of 4-1BBL. Recombinant human 4-1BBL is a soluble 19.5 kDa protein consisting of 185 amino acid residues.
Endotoxin Levels	< 0.1 ng/µg of protein (<1EU/µg)
Length [aa]	185
Molecular Weight	19.5 kDa
mRNA RefSeq	NM_003811.3
Protein RefSeq	NP_003802.1
Protein Sequence	MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Purity Confirmation	> 97% by SDS-PAGE & HPLC analyses
Synonyms	TNFSF9; CD137L; 4-1BB-L
Uniprot ID	P41273

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Delivery expected until 8/16/2024