« Back
Home /
Osteoprotegerin (OPG)

Osteoprotegerin (OPG)

Item no.	RLT-100-089S
Manufacturer	ReliaTech
Amount	10ug
Category	Metabolism Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Human, Mouse, Rat
Host	E.coli
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	TNFRSF11B, OPG, TR1, OCIF
Available
NCBI Gene ID	4982
Uniprot	O00300
Biological Activity	Determined by its ability to neutralize the stimulation of U937 cells treated with 10 ng/ml of soluble RANKL (sRANKL).
Description	Osteoprotegerin (OPG) is a member of the TNFR superfamily that can act as a decoy receptor for RANKL. Binding of soluble OPG to sRANKL inhibits osteoclastogenesis by interrupting the signaling between stromal cells and osteoclastic progenitor cells, thereby leading to excess accumulation of bone and cartilage. OPG is expressed in a wide variety of tissues including adult heart, lung, kidney, liver, spleen, prostate, lymph node and bone marrow. OPG is secreted both as a monomeric and a dimeric protein. Its primary structure consists of seven distinct domains, four of which corresponds to the extracellular cysteine-rich domains of TNFR proteins and constitutes the soluble OPG. Recombinant human OPG is a soluble 20.0 kDa protein containing 174 amino acid residues.
Endotoxin Levels	< 0.1 ng/µg of protein (<1EU/µg)
Length [aa]	174
Molecular Weight	20 kDa
mRNA RefSeq	NM_002546.3
Protein RefSeq	NP_002537.3
Protein Sequence	METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK
Purity Confirmation	> 98% by SDS-PAGE & HPLC analyses
Synonyms	TNFRSF11B; OPG; TR1; OCIF
Uniprot ID	O00300

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Delivery expected until 9/20/2024

Express Delivery: Save 18 days

Compare

Add to wishlist

Recommend by mail