« Back
Home /
IP-10 (CXCL10)

IP-10 (CXCL10)

Item no.	RLT-M10-025S
Manufacturer	ReliaTech
Amount	5ug
Category	Oncology Neuroscience Neuroinflammation By Cell Type Peptides & Proteins Recombinant Proteins
Type	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Human, Mouse, Rat, Monkey
Host	E.coli
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	Cxcl10, C7, IP10, CRG-2, INP10, IP-10, Ifi10, mob-1, Scyb10, gIP-10
Available
NCBI Gene ID	15945
Uniprot	P17515
Biological Activity	Assay #1: Determined by its ability to chemoattract IL-2 activated T cells using a concentration range of 0.1-10.0 ng/ml. Assay #2: Determined by its ability to chemoattract CXCR3 transfected/HEK293 cells using a concentration range of 100-500 ng/ml.
Description	Murine IP-10 is produced by several cell types during the delayed type hypersensitivity response. IP-10 acts as a chemoattractant towards monocytes, lymphocytes, and certain T cells. Recombinant Murine IP-10 is a 8.7 kDa protein, containing 77 amino acid residues.
Endotoxin Levels	< 0.1 ng/µg of protein (<1EU/µg)
Length [aa]	77
Molecular Weight	8.7 kDa
mRNA RefSeq	NM_021274.2
Protein RefSeq	NP_067249.1
Protein Sequence	IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Purity Confirmation	> 98% by SDS-PAGE & HPLC analyses
Synonyms	Cxcl10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
Uniprot ID	P17515

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 5ug

available

Delivery expected until 8/16/2024