« Back
Home /
Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)

Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)

Item no.	HY-P1459-1ea
Manufacturer	MedChem Express
Amount	1 ea
Category	Reagents & Chemicals Other Chemicals
Type	Chemicals
Specific against	other
Formula	C159H250N50O37S
Citations	[1]Ma XW, et al. A truncated Sph12-38 with potent antimicrobial activity showing resistance against bacterial challenge in Oryzias melastigma. Fish Shellfish Immunol. 2017 Aug;67:561-570.
Smiles	[FITC-KAKAKAVSRSARAGLQFPVGRIHRHLK]
ECLASS 10.1	32160000
ECLASS 11.0	32160000
UNSPSC	12000000
Available
Product Description	Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.
Shipping	Room temperature
Manufacturers Applications	Neuroscience-Neuromodulation
MolecularWeight	3372.91
Clinical_Information	No Development Reported
Manufacturers Research_Area	Infection
Solubility	10 mM in H2O
Manufacturers Target	Bacterial
Pathway	Anti-infection
Manufacturers Product type	Peptides

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 ea

available

Request delivery time