« Back
Home /
Ras-Related C3 Botulinum Toxin substrate 1, Human Recombinant

Ras-Related C3 Botulinum Toxin substrate 1, Human Recombinant

Manufacturer	Raybiotech
Category	Peptides & Proteins Recombinant Proteins Cell Biology Cytoskeleton small GTPases Rho Subfamily
Type	Proteins Recombinant
Specific against	Human
Format	Sterile Filtered colorless solution.
Amount	1 mg
Quantity options	50 ug 1 mg
Item no.	228-11350-3
Targets	RAC1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Purity	Greater than 95.0% as determined by SDS-PAGE.
Storage/Stability	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Formulation	The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT.
Expressed Region	MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL.
Protein Name & Synonyms	P21-RAC1, RAC-1, RAC1, RAS-like protein TC25, MIG5, Cell-migration-inducing gene 5 protein, Ras-related C3 botulinum toxin substrate 1, rho family small GTP binding protein Rac1, TC-25, MGC111543.
Expression System	E.Coli

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.