« Back
Home /
IP-10, Human Recombinant (CXCL10)

IP-10, Human Recombinant (CXCL10)

Item no.	228-10970-3
Manufacturer	Raybiotech
Amount	1 mg
Quantity options	25 ug 1 mg
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against	Human
Purity	Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	IP-10 /
Available
Storage/Stability	Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation	Lyophilized from a 0.2 um filtered concentrated (0.5mg/ml) solution in 20mM PB, pH 7.4 and 150mM NaCl.
Expressed Region	VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKEMSKRSP.
Protein Name & Synonyms	Small inducible cytokine B10, CXCL10, 10 kDa interferon-gamma-induced protein, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10.
Expression System	E.Coli
Molecular Weight (kDa)	8.6 kDa

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.