« Back
Home /
Anti-RAF1 Antibody

Anti-RAF1 Antibody

Item no.	101-11392
Manufacturer	Raybiotech
Amount	100 ug
Category	Oncology Antibodies Western Blot ELISA Primary Antibodies By Organ Heart & Blood Cancer Proximity Ligation Analysis RNAi
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, ELISA, RNAi, PLA
Clone	Monoclonal
Specific against	Human, Rat
Host	Hamster - Armenian
Isotype	IgG2b Kappa
Sequence	MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQR RASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHD CLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS LIGEELQVDF
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	RAF1
Available
Specificity	Human
Target Name	v-raf-1 murine leukemia viral oncogene homolog 1
Accession Number	AAH18119
Gene Symbol	RAF1
Gene ID	5894
Target Synonyms	CRAF, NS5, Raf-1, c-Raf
Application notes:	WB-Ti, WB-Ce, PLA-Ce, WB-Tr, ELISA, WB-Re, RNAi-Ab
Product Description	Human RAF1 monoclonal antibody (100 ug)
Immunogen	RAF1 (AAH18119, 1 a.a. ca. 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-11392.pdf

101-11392-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/20/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail