« Back
Home /
Anti-PML Antibody

Anti-PML Antibody

Item no.	101-11283
Manufacturer	Raybiotech
Amount	100 ug
Category	Oncology Antibodies Western Blot ELISA Immunofluorescence Primary Antibodies By Organ Heart & Blood Cancer Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, IF, ELISA, PLA
Clone	Monoclonal
Specific against	Human, Rat
Host	Hamster - Armenian
Isotype	IgG2a Kappa
Sequence	RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKE ARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVF LPNSNHVASGAGEAEERVVV
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	PML
Available
Specificity	Human
Target Name	promyelocytic leukemia
Accession Number	AAH00080
Gene Symbol	PML
Gene ID	5371
Target Synonyms	MYL, PP8675, RNF71, TRIM19
Application notes:	PLA-Ce, S-ELISA, ELISA, WB-Re, IF, WB-Ce
Product Description	Human PML monoclonal antibody (100 ug)
Immunogen	PML (AAH00080, 411 a.a. ca. 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-11283.pdf

101-11283-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/20/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail