« Back
Home /
Anti-HSPA1L Antibody

Anti-HSPA1L Antibody

Item no.	101-10754
Manufacturer	Raybiotech
Amount	100 ug
Category	Antibodies Immunohistochemistry Western Blot ELISA Primary Antibodies Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, IHC, ELISA, PLA
Clone	Monoclonal
Specific against	Human, Rat
Host	Hamster - Armenian
Isotype	IgG1 Kappa
Sequence	KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEV D
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	HSPA1L
Available
Specificity	Human
Target Name	heat shock 70kDa protein 1-like
Accession Number	NP_005518
Gene Symbol	HSPA1L
Gene ID	3305
Target Synonyms	HSP70-1L, HSP70-HOM, HSP70T, hum70t
Application notes:	PLA-Ce, S-ELISA, ELISA, WB-Re, WB-Ce, IHC-P
Product Description	Human HSPA1L monoclonal antibody (100 ug)
Immunogen	HSPA1L (NP_005518, 561 a.a. ca. 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-10754.pdf

101-10754-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/20/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail