« Back
Home /
Anti-SMAD4 Antibody

Anti-SMAD4 Antibody

Item no.	101-11595
Manufacturer	Raybiotech
Amount	100 ug
Quantity options	200 ul 100 ug
Category	Oncology Antibodies Western Blot ELISA Primary Antibodies By Organ Colorectal Cancer Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, ELISA, PLA
Clone	Monoclonal
Specific against	Human
Host	Hamster - Armenian
Isotype	IgG2a Kappa
Sequence	SLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIY ARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYER VVSPGIDLSGLTLQSNAPSSMMVKDEYVHD
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	SMAD4
Available
Specificity	Human
Target Name	SMAD family member 4
Accession Number	NP_005350
Gene Symbol	SMAD4
Gene ID	4089
Target Synonyms	DPC4, JIP, MADH4
Application notes:	PLA-Ce, S-ELISA, ELISA, WB-Re
Product Description	Human SMAD4 monoclonal antibody (100 ug)
Immunogen	SMAD4 (NP_005350, 56 a.a. ca. 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-11595.pdf

101-11595-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/20/2024