« Back
Home /
Anti-RET Antibody

Anti-RET Antibody

Item no.	101-11437
Manufacturer	Raybiotech
Amount	100 ug
Category	Oncology Antibodies Western Blot ELISA Primary Antibodies By Organ Thyroid Cancer Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, ELISA, PLA
Clone	Monoclonal
Specific against	Human (Homo sapiens)
Host	Hamster - Armenian
Isotype	IgG2a Kappa
Sequence	NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPV SLHLPSTYSLSVSRRARRFAQIGKVCVENCLADLTGDAVS GRDEARSSGLGSQKHPGS
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	RET
Shipping condition	Cool pack
Available
Specificity	Human
Manufacturer - Type	Antibodies\|Primary Antibodies
Storage Conditions	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration	12 months from the date of shipment when stored properly.
Format	In 1x PBS, pH 7.2
Gene Symbols	RET
Protein Name & Synonyms	RET
Concentration	0.5 mg/ml (lot specific)
Specicifity	Human
Buffers	1x PBS, pH 7.2
Clonality	Monoclonal

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-11437.pdf

101-11437-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 2/7/2025