« Back
Home /
Anti-PRKACA Antibody

Anti-PRKACA Antibody

Item no.	101-11322
Manufacturer	Raybiotech
Amount	100 ug
Category	Oncology Neuroscience Metabolism Diabetes Targets for Rodent Neurosciences Neural Signaling Antibodies By Cell Type Melanoma Western Blot ELISA Primary Antibodies Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, ELISA, PLA
Clone	Monoclonal
Specific against	Human
Host	Hamster - Armenian
Isotype	IgG1 Kappa
Sequence	MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAH LDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKV VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	PRKACA
Available
Specificity	Human
Target Name	protein kinase, cAMP-dependent, catalytic, alpha
Accession Number	AAH39846
Gene Symbol	PRKACA
Gene ID	5566
Target Synonyms	MGC102831, MGC48865, PKACA
Application notes:	PLA-Ce, S-ELISA, ELISA, WB-Re
Product Description	Human PRKACA monoclonal antibody (100 ug)
Immunogen	PRKACA (AAH39846, 1 a.a. ca. 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-11322.pdf

101-11322-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/20/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail