« Back
Home /
Anti-PRKACA Antibody

Anti-PRKACA Antibody

Item no.	101-11322
Manufacturer	Raybiotech
Amount	100 ug
Category	Oncology Neuroscience Metabolism Diabetes Targets for Rodent Neurosciences Neural Signaling Antibodies By Cell Type Melanoma Western Blot ELISA Primary Antibodies Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, ELISA, PLA
Clone	Monoclonal
Specific against	Human (Homo sapiens)
Host	Hamster - Armenian
Isotype	IgG1 Kappa
Sequence	MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAH LDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKV VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	PRKACA
Shipping condition	Cool pack
Available
Specificity	Human
Format	In 1x PBS, pH 7.2
Gene Symbols	PRKACA
Storage/Stability	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Protein Name & Synonyms	PRKACA
Specicifity	Human
Expiration	12 months from the date of shipment when stored properly.
Clonality	Monoclonal
Storage Buffer	1x PBS, pH 7.2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-11322.pdf

101-11322-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail