« Back
Home /
Anti-PLCG1 Antibody

Anti-PLCG1 Antibody

Item no.	101-11275
Manufacturer	Raybiotech
Amount	100 ug
Category	Antibodies Western Blot ELISA Immunofluorescence Primary Antibodies Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, IF, ELISA, PLA
Clone	Monoclonal
Specific against	Human
Host	Hamster - Armenian
Isotype	IgG1 Kappa
Sequence	LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRE RGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADH FDSRERRAPRRTRVNGDNRL
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	PLCG1
Available
Specificity	Human
Target Name	phospholipase C, gamma 1
Accession Number	NP_002651
Gene Symbol	PLCG1
Gene ID	5335
Target Synonyms	PLC-II, PLC1, PLC148, PLCgamma1
Application notes:	PLA-Ce, S-ELISA, ELISA, WB-Re, IF, WB-Ce
Product Description	Human PLCG1 monoclonal antibody (100 ug)
Immunogen	PLCG1 (NP_002651, 1192 a.a. ca. 1291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-11275.pdf

101-11275-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/20/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail