« Back
Home /
Anti-PIK3CA Antibody

Anti-PIK3CA Antibody

Item no.	101-11252
Manufacturer	Raybiotech
Amount	100 ug
Category	Oncology Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Status Adenocarcinoma Mesothelioma ELISA Autophagy Cardiovascular Research Proliferation Myocardial Infarction Primary Antibodies Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	ELISA, PLA
Clone	Monoclonal
Specific against	Human
Host	Hamster - Armenian
Isotype	IgG1 Kappa
Sequence	DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLF INLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEY FMKQMNDAHHGGWTTKMDWIFHTIKQHALN
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	PIK3CA
Available
Specificity	Human
Target Name	phosphoinositide-3-kinase, catalytic, alpha polypeptide
Accession Number	NP_006209
Gene Symbol	PIK3CA
Gene ID	5290
Target Synonyms	MGC142161, MGC142163, PI3K, p110-alpha
Application notes:	PLA-Ce, S-ELISA, ELISA
Product Description	Human PIK3CA monoclonal antibody (100 ug)
Immunogen	PIK3CA (NP_006209, 959 a.a. ca. 1068 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-11252.pdf

101-11252-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/20/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail