« Back
Home /
Anti-DAPK1 Antibody

Anti-DAPK1 Antibody

Item no.	101-10373
Manufacturer	Raybiotech
Amount	100 ug
Category	Antibodies ELISA Primary Antibodies Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	ELISA, PLA
Clone	Monoclonal
Specific against	Human
Host	Hamster - Armenian
Isotype	IgG1 Kappa
Sequence	LLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPV MIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHD VYSQASLGMDIHASDLNLLT
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	DAPK1
Available
Specificity	Human
Target Name	death-associated protein kinase 1
Accession Number	NP_004929
Gene Symbol	DAPK1
Gene ID	1612
Target Synonyms	DAPK, DKFZp781I035
Application notes:	PLA-Ce, S-ELISA, ELISA
Product Description	Human DAPK1 monoclonal antibody (100 ug)
Immunogen	DAPK1 (NP_004929, 1211 a.a. ca. 1310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-10373.pdf

101-10373-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/20/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail