« Back
Home /
Anti-CTNNB1 Antibody

Anti-CTNNB1 Antibody

Item no.	101-10355
Manufacturer	Raybiotech
Amount	100 ug
Category	Antibodies Western Blot ELISA Immunofluorescence Primary Antibodies Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, IF, ELISA, PLA
Clone	Monoclonal
Specific against	Human
Host	Hamster - Armenian
Isotype	IgG2a Kappa
Sequence	LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHS GGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQD LMDGLPPGDSNQLAWFDTDL
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	CTNNB1
Available
Specificity	Human
Target Name	catenin (cadherin-associated protein), beta 1, 88kDa
Accession Number	AAH58926
Gene Symbol	CTNNB1
Gene ID	1499
Target Synonyms	CTNNB, DKFZp686D02253, FLJ25606, FLJ37923
Application notes:	IF, S-ELISA, PLA-Ce, ELISA, WB-Re, WB-Tr
Product Description	Human CTNNB1 monoclonal antibody (100 ug)
Immunogen	CTNNB1 (AAH58926, 682 a.a. ca. 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-10355.pdf

101-10355-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/20/2024