« Back
Home /
Anti-CSNK1E Antibody

Anti-CSNK1E Antibody

Item no.	101-10345
Manufacturer	Raybiotech
Amount	100 ug
Category	Neuroscience Molecular Targets for Neuroscience Antibodies ELISA Immunofluorescence Primary Antibodies Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	IF, ELISA, PLA
Clone	Monoclonal
Specific against	Human
Host	Hamster - Armenian
Isotype	IgG2a Kappa
Sequence	ELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLEC VKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMV MELLGPSLEDLFNFCSRKF
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	CSNK1E
Available
Specificity	Human
Target Name	casein kinase 1, epsilon
Accession Number	NP_689407
Gene Symbol	CSNK1E
Gene ID	1454
Target Synonyms	HCKIE, MGC10398
Application notes:	IF, PLA-Ce, S-ELISA, ELISA
Product Description	Human CSNK1E monoclonal antibody (100 ug)
Immunogen	CSNK1E (NP_689407, 2 a.a. ca. 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-10345.pdf

101-10345-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/20/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail