« Back
Home /
Anti-CDC25A Antibody

Anti-CDC25A Antibody

Item no.	101-10257
Manufacturer	Raybiotech
Amount	100 ug
Category	Antibodies Western Blot ELISA Primary Antibodies Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, ELISA, PLA
Clone	Monoclonal
Specific against	Human
Host	Hamster - Armenian
Isotype	IgG2a Kappa
Sequence	PVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERD SSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNE EETPSCMASLWTAPLVMRTT
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	CDC25A
Available
Specificity	Human
Target Name	cell division cycle 25 homolog A (S. pombe)
Accession Number	AAH07401
Gene Symbol	CDC25A
Gene ID	993
Target Synonyms	CDC25A2
Application notes:	PLA-Ce, S-ELISA, ELISA, WB-Re
Product Description	Human CDC25A monoclonal antibody (100 ug)
Immunogen	CDC25A (AAH07401, 151 a.a. ca. 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-10257.pdf

101-10257-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/20/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail