« Back
Home /
Recombinant human chorionic gonadotropin

Recombinant human chorionic gonadotropin

Item no.	THP-0139
Manufacturer	Creative BioMart
CASRN	177073-44-8
Amount	1ea
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Type	Proteins
Specific against	Human
Conjugate/Tag	#NV
Sequence	APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	177073-44-8
Similar products	177073-44-8
Available
Affected organisms	Humans and other mammals
Applications info	For the treatment of female infertility
Description	Recombinant human chorionic gonadotropin with 2 subunits, alpha = 92 residues, beta = 145 residues, each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.
Examples of Clinical Use	Female infertility
Mechanism of action	Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone.
Molecular Weight	25719.7 Da
Pharmacodynamics	The product is used to treat female infertility, the product stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. The product is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1ea

not available