« Back
Home /
Bovine adenosine deaminase

Bovine adenosine deaminase

Item no.	THP-0104
Manufacturer	Creative BioMart
CASRN	9026-93-1
Amount	1ea
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Cattle
Conjugate/Tag	#NV
Sequence	MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQE
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	9026-93-1
Similar products	9026-93-1
Available
Affected organisms	Humans and other mammals
Applications info	For treatment of adenosine deaminase deficiency.
Description	Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life.
Examples of Clinical Use	Adenosine deaminase deficiency
Mechanism of action	Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination.
Molecular Weight	40788.2 Da
Pharmacodynamics	Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1ea

not available