Item no. |
THP-0083 |
Manufacturer |
Creative BioMart
|
Amount |
1ea |
Category |
|
Type |
Proteins |
Specific against |
other |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
1117844-87-7 |
Similar products |
1117844-87-7 |
Available |
|
Description |
The product is a pegylated, recombinant granulocyte colony-stimulating factor (G-CSF) that was synthetized using a highly site-specific glycoPEGylation technology. The product is a covalent conjugate of Filgrastim with a single methoxy polyethylene glycol (PEG) molecule via a carbohydrate linker consisting of glycine, N-acetylneuraminic acid and N-acetylgalactosamine. The average molecular mass of the product comprises 18, 798 Da for Filgrastim, 203 Da for GalNAc, 338 Da for glycylsialic acid and approximately 20, 000 Da for PEG. |
Formula |
C866H1372N226O258S9*(C2H4O)n |
Sequences |
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
CAS No. |
1117844-87-7 |
Molecular Weight |
39000.0 Da (glycoPEGylated, approximate) |
Synonyms |
Not Available |
Applications info |
Indicated for the reduction in the duration of neutropenia and the incidence of febrile neutropenia in adult patients treated with cytotoxic chemotherapy for malignancy (with the exception of chronic myeloid leukaemia and myelodysplastic syndromes). |
Examples of Clinical Use |
Reduction in the duration of neutropenia and the incidence of febrile neutropenia |
Pharmacodynamics |
Mimicking endogenous granulocyte colony-stimulating factors, the product enhances the number and function of circulating neutrophils by binding to endogenous G-CSF receptors. A small increase in monocyte and/or lymphocyte counts may also be observed. Following a single subcutaneous dose administration of 100 ug/kg, the product resulted in a significant increase in neutrophilic granulocyte and large unstained cell counts. G-CSF also increases the antibacterial activities of neutrophils including the phagocytosis. Due to structural similarity between the product and pegfilgrastim, G-CSF receptor binding was equivalent between two molecules. However, the product showed greater time-dependent resistance to neutrophil elastase degradation and greater retention of activity than pegfilgrastim. |
Mechanism of action |
Endogenous granulocyte colony-stimulating factor (G-CSF) is a glycoprotein that stimulates neutrophil progenitors. It is produced mainly by monocytes, fibroblasts and endothelial cells to promote the development of neutrophils and increase their proliferation and maturation. Subsequently, G-SCF stimulates the release of matured neutrophils from the bone marrow storage pools into the peripheral blood to enhance their function. Via binding to to the human G-CSF receptors, lipegfilgrastim activates the receptor signalling pathway as a growth factor to stimulate proliferation of haematopoietic progenitor cells and their differentiation into mature cells, and promote subsequent release into the peripheral blood. This stimulatory effect of lipegfilgrastim may extend to other single lineage and multilineage progenitors and pluripotent haematopoietic stem cells. The presence of the PEG moiety in lipegfilgrastim decreases the plasma clearance and extends the drug's terminal elimination half-life, allowing for less frequent dosing. |
Affected organisms |
Not Available |
Targets |
Target 1. Granulocyte colony-stimulating factor receptor |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.