« Back
Home /
Recombinant Mouse S100A9/MRP14 Protein

Recombinant Mouse S100A9/MRP14 Protein

Item no.	RP03159LQ-100ug
Manufacturer	Abclonal
Amount	100 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
NCBI	S1A9/MRP14
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	S100-A9; Calgranulin-B; Calprotectin L1H subunit; MRP-14; p14; CAGB; MRP14;S100A9
Available
Background	S100A8 and S100A9 (also known as MRP8 and MRP14, respectively) are Ca2 binding proteins belonging to the S100 family. They often exist in the form of heterodimer, while homodimer exists very little because of the stability. S100A8/A9 is constitutively expressed in neutrophils and monocytes as a Ca2 sensor, participating in cytoskeleton rearrangement and arachidonic acid metabolism.
Route	N-His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg
Immunogen	Ala2-Lys113
Storage	This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Protein Size	14.1 kDa
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	S100A9/MRP14
Protein Formulation	Supplied as 0.22μm filtered solution in PBS, 1mM DTT, 20% Glycerol pH 7.5.
Protein Description	Recombinant Mouse S100A9/MRP14 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Lys113) of mouse S100A9/MRP14 fused with a His tag at the N-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 24 days

Compare

Add to wishlist

Recommend by mail