Item no. |
RP02955-100ug |
Manufacturer |
Abclonal
|
Amount |
100 ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
Purity |
> 95% as determined by HPLC |
Sequence |
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
NCBI |
S1-A8 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8,S100A8,CAGA,CFAG,CGLA,CP-10,L1Ag,MA387,MIF,MRP8,NIF,P8 |
Available |
|
Description |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
Background |
This protein is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Route |
C-His |
Manufacturers Category |
Proteins |
Endotoxin |
<1EU/μg |
Immunogen |
Met1-Glu93 |
Storage |
Store the lyophilized protein at -20°C to -80°C for 12 months.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Manufacturers Research Area |
Other Recombinant Protein |
Gene Symbol |
S100-A8 |
Protein Formulation |
Lyophilized from 0.22μm filtered solution in 2mM DTT, PBS (pH 7.2). |
Protein Description |
Recombinant Human S100-A8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu93) of human S100-A8 (Accession #NP_002955.2) fused with a 6×His tag at the C-terminus. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.