« Back
Home /
Recombinant Mouse PDGFB Protein

Recombinant Mouse PDGFB Protein

Item no.	RP02876-500ug
Manufacturer	Abclonal
Amount	500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
Purity	> 95% as determined by SDS-PAGE.
Sequence	SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
NCBI	PDGFB
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. As growth factor，it plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. It is required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. PDGFB also plays an important role in wound healing.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	<1EU/μg
Immunogen	Ser82-Thr190
Storage	Store the lyophilized protein at -20°C to -80°C for 12 months.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Growth Factor
Gene Symbol	PDGFB
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 4mM HCl.
Protein Description	Recombinant Mouse PDGFB Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser82-Thr190) of mouse PDGFB (Accession #NP_035187.2) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail