« Back
Home /
Recombinant Mouse IL-7 Protein

Recombinant Mouse IL-7 Protein

Item no.	RP02519-20ug
Manufacturer	Abclonal
Amount	20 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
Purity	> 98% by SDS-PAGE.
Sequence	MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
NCBI	IL-7
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL-7,IL-7 interleukin-7,interleukin-7,Lymphopoietin -1,PBGF
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	Interleukin 7 (IL-7) is a protein that in humans is encoded by the IL7 gene. IL-7 stimulates the differentiation of multipotent (pluripotent) hematopoietic stem cells into lymphoid progenitor cells. It is important for proliferation during certain stages of B-cell maturation, T and NK cell survival, development and homeostasis.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Interleukin, Cell Culture related
Gene Symbol	IL-7
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant Mouse IL-7 Protein is produced by Escherichia coli expression system. The target protein is expressed with sequence of Mouse IL-7 fused with polyhistidine tag at the C-terminus
Protein Bio Activity	Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED₅₀ for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 106 IU/mg.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 8/23/2024

Express Delivery: Save 11 days

Compare

Add to wishlist

Recommend by mail