Item no. |
RP02506-20ug |
Manufacturer |
Abclonal
|
Amount |
20 ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Purity |
> 98% by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
IL4,IL-4,IL-4B_cell stimulatory factor 1,interleukin 4,interleukin-4,Lymphocyte stimulatory factor 1,MGC79402,pitrakinra,B cell growth factor 1,BCDF,B-cell stimulatory factor 1,BCGF1,BCGF-1,binetrakin,BSF1,BSF-1,Binetrakin,Lymphocyte Stimulatory Factor1,Pitrakinra |
Available |
|
AntigenSeq |
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS |
BackGround |
The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th2 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13. |
Cross-Reactivity |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
GeneID(Human) |
IL-4 |
GeneSymbol |
IL-4 |
ProteinBioActivity |
Measured by its ability to inhibit TF-1 cells proliferation. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human IL-4 is approximately >2.8x 107 IU/mg. |
ProteinDescription |
Recombinant Human IL-4 Protein is produced by Escherichia coli expression system. The target protein is expressed with sequence of Human IL-4 fused with polyhistidine tag at the C-terminus |
ProteinFormulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0. |
RecommandDilutionA |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0. |
Route |
C-His |
Storage |
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.