« Back
Home /
Recombinant Human IL-4 Protein

Recombinant Human IL-4 Protein

Item no.	RP02506-20ug
Manufacturer	Abclonal
Amount	20 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Purity	> 98% by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL4,IL-4,IL-4B_cell stimulatory factor 1,interleukin 4,interleukin-4,Lymphocyte stimulatory factor 1,MGC79402,pitrakinra,B cell growth factor 1,BCDF,B-cell stimulatory factor 1,BCGF1,BCGF-1,binetrakin,BSF1,BSF-1,Binetrakin,Lymphocyte Stimulatory Factor1,Pitrakinra
Available
AntigenSeq	MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
BackGround	The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th2 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13.
Cross-Reactivity	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneID(Human)	IL-4
GeneSymbol	IL-4
ProteinBioActivity	Measured by its ability to inhibit TF-1 cells proliferation. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human IL-4 is approximately >2.8x 107 IU/mg.
ProteinDescription	Recombinant Human IL-4 Protein is produced by Escherichia coli expression system. The target protein is expressed with sequence of Human IL-4 fused with polyhistidine tag at the C-terminus
ProteinFormulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.
RecommandDilutionA	Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.
Route	C-His
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail