« Back
Home /
Recombinant Human PDGF-AA Protein

Recombinant Human PDGF-AA Protein

Item no.	RP01772-20ug
Manufacturer	Abclonal
Amount	20 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Sequence	SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
NCBI	PDGFA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	PDGF1; PDGF-A
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Platelet-derived growth factor alpha (PDGFA) is frequently upregulated in various cancers and thought to function as a key player in the development and progression of tumor growth by regulating aspects of cell proliferation, angiogenesis and metastasis. The human platelet-derived growth factor A chain gene (PDGFA) on chromosome 7p22 encodes an important mitogen. Within PDGFA lies a complex minisatellite structure that results in partial duplications of exon 4 and the IVS4 splice donor site.
Route	No-tag
Manufacturers Category	Proteins
Endotoxin	＜0.1EU/μg
Immunogen	Ser87-Thr211
Storage	Store the lyophilized protein at -20°C to -80°C for 12 months.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine receptors
Gene Symbol	PDGFA
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc，pH 4.5
Protein Description	Recombinant Human PDGF-AA Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser87-Thr211) of human PDGF-AA (Accession #NP_002598.4) fused with no additional amino acid.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail