Comparison

Recombinant Rat FGF-2/bFGF Protein European Partner

Item no. RP01759-100ug
Manufacturer Abclonal
Amount 100 ug
Category
Type Proteins Recombinant
Specific against Rat
Sequence ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NCBI FGF-2/bFGF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias bFGF; Fgf-2; Fgf2a;FGF2
Available
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
FGF basic is a member of the FGF family of at least 23 related mitogenic proteins which show 35-60% amino acid conservation. FGF acidic and basic, unlike the other members of the family, lack signal peptides and are apparently secreted by mechanisms other than the classical protein secretion pathway. FGF basic has been isolated from a number of sources, including neural tissue, pituitary, adrenal cortex, corpus luteum, and placenta. This factor contains four cysteine residues, but reduced FGF basic retains full biological activity, indicating that disulfide bonds are not required for this activity. bFGF is a critical component of human embryonic stem cell culture medium; the growth factor is necessary for the cells to remain in an undifferentiated state, although the mechanisms by which it does this are poorly defined. It has been demonstrated to induce gremlin expression which in turn is known to inhibit the induction of differentiation by bone morphogenetic proteins. It is necessary in mouse-feeder cell dependent culture systems, as well as in feeder and serum-free culture systems.
Route
C-6His
Manufacturers Category
Proteins
Endotoxin
<1EU/μg
Immunogen
Ala11-Ser154
Storage
Store the lyophilized protein at -20°C to -80°C for 12 months.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area
Cytokines & Cytokine receptors
Gene Symbol
FGF-2/bFGF
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description
Recombinant Rat FGF-2/bFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala11-Ser154) of rat FGF-2/bFGF (Accession #NP_062178.1) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close