« Back
Home /
Recombinant Mouse CXCL1/GRO-alpha Protein

Recombinant Mouse CXCL1/GRO-alpha Protein

Item no.	RP01641-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
Purity	> 97% by SDS-PAGE.
Sequence	RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
NCBI	CXCL1/GRO-alpha
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	KC; Fsp; N51; gro; Gro1; Mgsa; Scyb1;CXCL1
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation.Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation.
Route	C-hFc
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Immunogen	Arg20-Lys96
Storage	Store the lyophilized protein at -20°C to -80°C for 12 months.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine receptors
Gene Symbol	CXCL1/GRO-alpha
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant Mouse CXCL1/GRO-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg20-Lys96) of mouse CXCL1/GRO-alpha (Accession #NP_032202.1) fused with and a hFc tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail