« Back
Home /
Recombinant Mouse CCL2/MCP-1 Protein

Recombinant Mouse CCL2/MCP-1 Protein

Item no.	RP01622-20ug
Manufacturer	Abclonal
Amount	20 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
NCBI	CCL2/MCP-1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C-C motif chemokine ligand 2, CCL2, GDCF-2, HC11, HSMCR30, MCAF, Mcp1, MCP-1, SCYA2, SMC-CF,CCL2
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Monocyte chemoattractant protein 1 (MCP-1), also called CCL2, belongs to a group of CC chemokines located in chromosome 17q11.2. MCP-1 protein interacts with chemokine C-C motif receptor 2 (CCR2) to activate and recruit monocytes, macrophages, CD4+ T cells and immature dendritic cells to the site of infection. The presence of MCP-1 protein in an adequate concentration is important for granuloma formation and M. tuberculosis clearance.
Route	C-hFC
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Immunogen	Gln 24-Asn148
Storage	Store the lyophilized protein at -20°C to -80°C for 12 months.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine receptors
Gene Symbol	CCL2/MCP-1
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant Mouse CCL2/MCP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln 24-Asn148) of mouse CCL2/MCP-1 (Accession #NP_035463.1) fused with a hFc tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail