Item no. |
RP01607-100ug |
Manufacturer |
Abclonal
|
Amount |
100 ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Mouse |
Purity |
> 95% by SDS-PAGE. |
Sequence |
QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN |
NCBI |
CCL2 |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
C-C motif chemokine ligand 2,CCL2,GDCF-2,HC11,HSMCR30,MCAF,Mcp1,MCP-1,SCYA2,SMC-CF,CCL2 |
Available |
|
Description |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Route |
C-His |
Manufacturers Category |
Proteins |
Endotoxin |
<0.1EU/μg |
Immunogen |
Gln 24-Asn148 |
Storage |
Store the lyophilized protein at -20°C to -80°C for 12 months.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Manufacturers Research Area |
Cytokines & Cytokine receptors |
Gene Symbol |
CCL2 |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Protein Description |
Recombinant Mouse CCL2/MCP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln 24-Asn148) of mouse CCL2/MCP-1 (Accession #NP_035463.1) fused with a 6×His tag at the C-terminus. |
Protein Bio Activity |
Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is typically 6.2-25.0 ng/mL. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.