« Back
Home /
Recombinant Human Parathormone/PTH Protein

Recombinant Human Parathormone/PTH Protein

Item no.	RP01587-20ug
Manufacturer	Abclonal
Amount	20 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Purity	> 95% by SDS-PAGE.
Sequence	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
NCBI	Pahormone/PTH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	PTH, PTH1, parathyroid hormone,PTH1
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration inextracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cellsin bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor asparathyroid hormone and has major effects on development. Like most other protein hormones, parathyroidhormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packagedwithin the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secretedas a linear protein of 84 amino acids.
Route	No tag
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Immunogen	Ser32-Gln115
Storage	Store the lyophilized protein at -20°C to -80°C for 12 months.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	Pahormone/PTH
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant Human Parathormone/PTH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser32-Gln115) of human Parathormone/PTH (Accession #NP_000306.1) fused with no additional amino acid.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 9/27/2024