Comparison

Recombinant Human EGF Protein European Partner

Item no. RP01502-50ug
Manufacturer Abclonal
Amount 50 ug
Category
Type Proteins Recombinant
Specific against Human
Sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
NCBI EGF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Epidermal Growth Factor,HOMG4,URG
Available
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGF-alpha, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin binding EGF like growth factor (HB_x001e_EGF), epigen, and the neuregulins (NRG)-1 through -6. Members of this protein family have highly similar structural and functional characteristics. The 1207 amino acid (aa) human EGF precursor contains 9 EGF domains and 9 LDLR class B repeats. Human EGF is a 645-Da protein with 53 amino acid residues and three intramolecular disulfide bonds. EGF is a growth factor that stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. EGF is present in various body fluids, including blood, milk, urine, saliva, seminal fluid, pancreatic juice, cerebrospinal fluid, and amniotic fluid (4). Four ErbB (HER) family receptor tyrosine kinases including EGFR/ErbB1, ErbB2, ErbB3 and ErbB4, mediate responses to EGF family members (5). EGF binds ErbB1 and depending on the context, induces the formation of homodimers or heterodimers containing ErbB2. Dimerization results in autophosphorylation of the receptor at specific tyrosine residues to create docking sites for a variety of signaling molecules (5, ?8). EGF seems regulated by dietary inorganic iodine and plays an important physiological role in the maintenance of oro-esophageal and gastric tissue integrity.
Route
No tag
Manufacturers Category
Proteins
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Immunogen
Asn971-Arg1023
Storage
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area
Growth Factor, Cell Culture related
Gene Symbol
EGF
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description
1.Recombinant Human EGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn971-Arg1023) of human EGF (Accession #NP_001954.2) fused with no tag.2.Measured by its ability to stimulate AKT(Ser473) autophosphorylation in A431 cells. 10 ng/mL of Recombinant Human EGF can effectively enhance AKT(Ser473) autophosphorylation.
Protein Bio Activity
Active Recombinant Human EGF enhances AKT(Ser473) autophosphorylation in A431 cells. 10 ng/mL of Recombinant Human EGF can effectively enhance AKT(Ser473) autophosphorylation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close