Comparison

Recombinant Human Endoglin/CD105 Protein European Partner

Item no. RP01413-50ug
Manufacturer Abclonal
Amount 50 ug
Category
Type Proteins Recombinant
Specific against Human
Purity > 95% by SDS-PAGE.
Sequence ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFK
NCBI Endoglin/CD15
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Endoglin,CD105,HHT1,ORW1
Available
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
Endoglin, also known as CD105, is a type I homodimeric transmembrane glycoprotein with a large, disulfide-linked, extracellular region and a short, constitutively phosphorylated cytoplasmic tail. Endoglin contains an RGD tripeptide which is a key recognition structure in cellular adhesion, , suggesting a critical role for endoglin in the binding of endothelial cells to integrins and/or other RGD receptors. Endoglin is highly expressed on vascular endothelial cells, chondrocytes, and syncytiotrophoblasts of term placenta. It is also found on activated monocytes, mesenchymal stem cells and leukemic cells of lymphoid and myeloid lineages. As an accessory receptor for the TGF-β superfamily ligands, endoglin binds TGF-β1 and TGF-β3 with high affinity not by itself but by associating with TGF-β type II receptor (TβRII) and activates the downstream signal pathways. In addition, in human umbilical vein endothelial cells, ALK-1 is also a receptor kinase for endoglin threonine phosphorylation, and mutations in either of the two genes result in the autosomal-dominant vascular dysplasia, hereditary hemorrhagic telangiectasia (HHT). Endoglin has been regarded as a powerful biomarker of neovascularization, and is associated with several solid tumor types.
Route
C-His
Manufacturers Category
Proteins
Endotoxin
<0.1EU/μg
Immunogen
Glu26-Gly586
Storage
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area
Biosimilar Drug Targets
Gene Symbol
Endoglin/CD105
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description
Recombinant Human Endoglin/CD105 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu26-Gly586) of human Endoglin/CD105 (Accession #NP_001108225.1) fused with a 6×His tag at the C-terminus.
Protein Bio Activity
1.Measured by its binding ability in a functional ELISA. Immobilized Human CD105 at 2 μg/mL (100 μL/well) can bind Human ACVR2B with a linear range of 0.01-1.35 μg/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized Human CD105 at 2 μg/mL (100 μL/well) can bind Human TGFBR2 with a linear range of 0.01-1.72 μg/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close