« Back
Home /
Recombinant human BDNF Protein

Recombinant human BDNF Protein

Item no.	RP01243-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
NCBI	BDNF
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Brain-derived neurotrophic factor (BDNF) is a member of the nerve growth factor family.The neurotrophin family is comprised of at least four proteins including NGF, BDNF, NT-3, and NT-4/5. These secreted cytokines are synthesized as prepropeptides that are proteolytically processed to generate the mature proteins.BDNF cDNA encodes a 247 amino acid residue precursor protein with a signal peptide and a proprotein that are cleaved to yield the 119 amino acid residue mature BDNF. The amino acid sequence of mature BDNF is identical in all mammals examined. BDNF binds with high affinity and specifically activates the TrkB tyrosine kinase receptor .
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	His129-Arg247
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Growth Factor, Cell Culture related
Gene Symbol	BDNF
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human/Mouse/Rat BDNF Protein is produced by E. coli expression system. The target protein is expressed with sequence (His129-Arg247) of human BDNF (Accession #NP_733929.1.) fused with an initial Met at the N-terminus and a 6×His tag at the C-terminus.
Protein Bio Activity	1.Measured by its binding ability in a functional ELISA.Immobilized Recombinant Human BDNF at 1 μg/mL (100 μL/well) can bind BDNF Rabbit mAb with a linear range of 0.4-2.15ng/mL.\|2.Measured by its binding ability in a functional ELISA.Immobilized Recombinant Human TrkB at 2 μg/mL (100 μL/well) can bind Recombinant Human BDNF with a linear range of 1.95-258 ng/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail