« Back
Home /
Recombinant human Siglec-15/CD33L3 Protein

Recombinant human Siglec-15/CD33L3 Protein

Item no.	RP01187-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Oncology Neuroscience Neuroinflammation By Cell Type Hematology Leukemia Myeloma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
NCBI	Siglec-15/CD33L3
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, SIGLEC15, Siglec15
Similar products	SIGLEC15, CD33 antigen-like 3, sialic acid-binding Ig-like lectin 15, Siglec15
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-hFc&His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Phe20-Thr263
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Bio-Markers & CD Antigens
Gene Symbol	Siglec-15/CD33L3
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, 300mM NaCl, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Thr263) of human Siglec-15/CD33L3 (Accession #NP_998767.1) fused with a Fc, 6×His tag at the C-terminus.
Protein Bio Activity	Measured by its ability to inhibit Anti-CD3-induced proliferation of jurkat cells. The ED₅₀ for this effect is 1.8-7.2 μg/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 30 days

Compare

Add to wishlist

Recommend by mail