Item no. |
RP00905-50ug |
Manufacturer |
Abclonal
|
Amount |
50 ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
Host |
Human |
Purity |
> 95% by SDS-PAGE. |
Sequence |
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
NCBI |
IL-22 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Interleukin-22, IL-22, Cytokine Zcyto18, IL-10-related T-cell-derived-inducible factor, IL-TIF, IL22, ILTIF, ZCYTO18 |
Similar products |
IL22, IL-22, ILTIF, ZCYTO18, Interleukin-22, Cytokine Zcyto18, IL-10-related T-cell-derived-inducible factor, IL-TIF |
Available |
|
Description |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
Route |
No tag |
Manufacturers Category |
Proteins |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Immunogen |
Ala34-Ile179 |
Storage |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Manufacturers Research Area |
Interleukin, Biosimilar Drug Targets |
Gene Symbol |
IL-22 |
Protein Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation. |
Protein Description |
Recombinant Human IL-22 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala34-Ile179) of human IL-22 (Accession #Q9GZX6) fused with an initial Met at the N-terminus. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.