« Back
Home /
Recombinant Human CD200/OX-2/MOX1/MOX2 Protein

Recombinant Human CD200/OX-2/MOX1/MOX2 Protein

Item no.	RP00890-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Purity	> 95% by SDS-PAGE.
Sequence	QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
NCBI	CD2/OX-2/MOX1/MOX2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD200,MOX1,MOX2,MRC,OX-2
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
Route	C-Fc
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Gln31-Gly232
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Bio-Markers & CD Antigens
Gene Symbol	CD200/OX-2/MOX1/MOX2
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human CD200/OX-2/MOX1/MOX2 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Gln31-Gly232) of human CD200/OX-2/MOX1/MOX2 (Accession #P41217) fused with an Fc tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail