« Back
Home /
Recombinant Mouse TNFSF9/4-1BB Ligand Protein

Recombinant Mouse TNFSF9/4-1BB Ligand Protein

Item no.	RP00766-1000ug
Manufacturer	Abclonal
Amount	1000 ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis
Type	Proteins Recombinant
Specific against	Mouse
Host	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	RTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE
NCBI	TNFSF9/4-1BB Ligand
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tumor necrosis factor ligand superfamily member 9, 4-1BB ligand, 4-1BBL, Tnfsf9, Cd137l, Cd157l, Ly63l
Similar products	4-1BBL, Tnfsf9, Tumor necrosis factor ligand superfamily member 9, 4-1BB ligand, Cd137l, Cd157l, Ly63l
Available
Description	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Tumor necrosis factor ligand superfamily member 9, also known as 4-1BBL, is a member of the the tumornecrosis factor family. Mouse 4-1BBL cDNA encodes a 309 amino acid residues (aa) protein with an 82 aa N-terminal cytoplasmic domain, a 21 aa transmembrane domain and a 206 aa C-terminal extracellular domain.The extracellular domain of 4-1BBL has a tertiary structure similar to that of other TNFSF members, but sharesonly low aa sequence homology (14-16%). 4-1BBL is predominantly expressed on activated antigen presentingcells (APCs) such as B cells, macrophages and dendritic cells (DCs). It is also expressed on most T and Blymphoma cell lines. TNFSF9 has been shown to reactivate anergic T lymphocytes in addition to promoting Tlymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses inCD8 T cells, and is thought to be involved in T cell-tumor cell interaction.
Route	N-His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Arg104-Glu309
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint, TNF family
Gene Symbol	TNFSF9/4-1BB Ligand
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Mouse TNFSF9/4-1BB Ligand Protein is produced by Human cells expression system. The target protein is expressed with sequence (Arg104-Glu309) of mouse TNFSF9/4-1BB Ligand (Accession #P41274) fused with a 10×His tag at the N-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 ug

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail