« Back
Home /
Recombinant Mouse CD47/IAP/OA3 Protein

Recombinant Mouse CD47/IAP/OA3 Protein

Item no.	RP00711-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK
NCBI	CD47/IAP/OA3
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Leukocyte Surface Antigen CD47, Antigenic Surface Determinant Protein OA3, Integrin-AssociatedProtein, IAP, Protein MER6, CD47, MER6
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	CD47, also known as Integrin‑Associated Protein (IAP) and OA3, is a glycosylated atypical member of theimmunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellulardomain (ECD) with a single Ig‑like domain, five membrane-spanning regions with short intervening loops, andC‑terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1on platelets, and in the modulation of integrins. It plays an important role in memory formation and synapticplasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immaturedendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cellactivation. It may play a role in membrane transport and/or integrin dependent signal transduction. It alsoprevents premature elimination of red blood cells.
Route	C-hFc
Manufacturers Category	Proteins
Endotoxin	< 0.01 EU/μg
Immunogen	Gln19-Lys140
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint
Gene Symbol	CD47/IAP/OA3
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Protein Description	Recombinant Mouse CD47/IAP/OA3 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln19-Lys140) of mouse CD47/IAP/OA3 (Accession #Q61735-1) fused with an Fc tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 30 days

Compare

Add to wishlist

Recommend by mail