« Back
Home /
Recombinant Mouse IFNA2/IFN-alpha 2 Protein

Recombinant Mouse IFNA2/IFN-alpha 2 Protein

Item no.	RP00688-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE
NCBI	IFNA2/IFN-alpha 2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interferon Alpha-2, IFN-Alpha-2, Interferon Alpha-A, LeIF A, IFNA2
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
Background	At least 23 different variants of Interferon- α are known. The individual proteins have molecular massesbetween 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- α subtypespossess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN- α subtypes differ in their sequences at only one or two positions.Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxyl-terminal end.
Route	No tag
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Cys24-Glu190
Storage	This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Manufacturers Research Area	Cytokines & Cytokine Receptors
Gene Symbol	IFNA2/IFN-alpha 2
Protein Formulation	Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.
Protein Description	Recombinant Mouse IFNA2/IFN-alpha 2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys24-Glu190) of mouse IFNA2/IFN-alpha 2 (Accession #P01573) fused with an initial Met at the N-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 30 days

Compare

Add to wishlist

Recommend by mail