« Back
Home /
Recombinant Human R-spondin-1/RSPO1 Protein

Recombinant Human R-spondin-1/RSPO1 Protein

Item no.	RP00602-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Purity	> 95% by SDS-PAGE.
Sequence	RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
NCBI	R-spondin-1/RSPO1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RSPO1,CRISTIN3,RSPO
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	RSPO1 is a secreted protein, containing 2 FU(furin-like) repeats and 1 TSP type-1 domain and belonging to theR-spondin family. RSPO1 is required for the early development of gonads, regardless of sex. It has been foundin mice only eleven days after fertilization. To induce cell proliferation, it acts synergistically with WNT4. Theyhelp stabilize β catenin, which activates downstream targets. RSPO1 is necessary in female sex development. Itaugments the WNT/ β catenin pathway to oppose male sex development. In critical gonadal stages, betweensix and nine weeks after fertilization, the ovaries upregulate it while the testes downregulate it. RSPO1 canpotentially aid in the treatment of mucositis, which is characterized by inflammation of the oral cavity. Thisunfortunate condition often accompanies chemotherapy and radiation in cancer patients with head and necktumors.
Route	C-6×His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Arg31-Ala263
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine Receptors
Gene Symbol	R-spondin-1/RSPO1
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human R-spondin-1/RSPO1 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Arg31-Ala263) of human R-spondin-1/RSPO1 (Accession #Q2MKA7) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 30 days

Compare

Add to wishlist

Recommend by mail