Item no. |
RP00587-10ug |
Manufacturer |
Abclonal
|
Amount |
10 ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
Purity |
> 95% by SDS-PAGE. |
Sequence |
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
NCBI |
IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Interferon alpha-1/13;IFN-alpha-1/13; Interferon alpha-D;LeIF D;IFNA1;IFNA13 |
Available |
|
Description |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
Background |
Interferon alpha-1/13(IFN-alpha-1/13 for short), also known as Interferon alpha-D, is a secreted protein whichbelongs to the alpha/beta interferon family. It is produced by macrophages. IFN-alpha have antiviral activities.Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. IFN-alpha exerts a variety of other biological effects, including antitumor and immunomodulatory activities and areincreasingly used clinically to treat a range of malignancies, myelodysplasias and autoimmune diseases. |
Route |
C-6×His |
Manufacturers Category |
Proteins |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Immunogen |
Cys24-Glu189 |
Storage |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Manufacturers Research Area |
Cytokines & Cytokine Receptors |
Gene Symbol |
IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 |
Protein Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation. |
Protein Description |
Recombinant Human IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Cys24-Glu189) of human IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 (Accession #P01562) fused with a 6×His tag at the C-terminus. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.