« Back
Home /
Recombinant Human IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 Protein

Recombinant Human IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 Protein

Item no.	RP00587-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Purity	> 95% by SDS-PAGE.
Sequence	CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
NCBI	IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interferon alpha-1/13;IFN-alpha-1/13; Interferon alpha-D;LeIF D;IFNA1;IFNA13
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	Interferon alpha-1/13(IFN-alpha-1/13 for short), also known as Interferon alpha-D, is a secreted protein whichbelongs to the alpha/beta interferon family. It is produced by macrophages. IFN-alpha have antiviral activities.Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. IFN-alpha exerts a variety of other biological effects, including antitumor and immunomodulatory activities and areincreasingly used clinically to treat a range of malignancies, myelodysplasias and autoimmune diseases.
Route	C-6×His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Cys24-Glu189
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine Receptors
Gene Symbol	IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Cys24-Glu189) of human IFNA1/IFNA13/IFN-alphaD/IFN-alpha 1/13 (Accession #P01562) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail