Comparison

Recombinant Human Cystatin F/CST7 Protein European Partner

Item no. RP00342-50ug
Manufacturer Abclonal
Amount 50 ug
Category
Type Proteins Recombinant
Specific against Human
Purity > 95% by SDS-PAGE.
Sequence GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
NCBI Cystatin F/CST7
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CST7,CMAP
Available
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. This gene encodes a glycosylated cysteine protease inhibitor with a putative role in immune regulation through inhibition of a unique target in the hematopoietic system. Expression of the protein has been observed in various human cancer cell lines established from malignant tumors.
Route
C-6×His
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Gly20-His145
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Cytokines & Cytokine Receptors
Gene Symbol
Cystatin F/CST7
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 20 mM TrisHCl, 150 mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Protein Description
Recombinant Human Cystatin F/CST7 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Gly20-His145) of human Cystatin F/CST7 (Accession #O76096) fused with a 6×His tag at the C-terminus.
Protein Bio Activity
Measured by its ability to inhibit active Cathepsin L cleavage of a fluorogenic peptide substrate Z-LR-AMC, The IC50 value is <6.0 nM.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close