Item no. |
RP00192-10ug |
Manufacturer |
Abclonal
|
Amount |
10 ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
Host |
Human |
Purity |
> 90% by SDS-PAGE. |
Sequence |
TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP |
NCBI |
IL-22RA2/IL22BP |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
CRF2-10, CRF2-S1, CRF2X, IL-22BP, IL-22R-alpha-2, IL-22RA2, ZCYTOR16 |
Similar products |
CRF2-10, CRF2-S1, CRF2X, IL-22BP, IL-22R-alpha-2, IL-22RA2, ZCYTOR16 |
Available |
|
Description |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Background |
Interleukin 22 binding protein (IL-22BP), also known as CRF2-10, CRF2-X, and IL-22RA2, is a 35-45 kDa secreted glycoprotein in the type II cytokine receptor family (CRF). IL-22BP specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor.IL-22BP is produced by dendritic cells (DC), epithelial cells, activated B cells, and activated monocytes. It is constitutively expressed by DC but is down-regulated during local inflammation and in response to tissue damage. IL-22BP is critical for limiting IL-22 induced epithelial cell proliferation during wound healing, and its deficiency can enable uncontrolled proliferation and enhance tumor development. |
Route |
C-His |
Manufacturers Category |
Proteins |
Endotoxin |
< 0.1 EU/μg of the protein by LAL method. |
Immunogen |
Thr22-Pro231 |
Storage |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Manufacturers Research Area |
Interleukin |
Gene Symbol |
IL-22RA2/IL22BP |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation. |
Protein Description |
Recombinant Human IL-22RA2/IL22BP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr22-Pro231) of human IL-22BP/IL-22RA2 (Accession #NP_851826.1) fused with a 6×His tag at the C-terminus. |
Protein Bio Activity |
Measured by its binding ability in a functional ELISA. Immobilized recombinant Human IL22 at 2 μg/mL (100 μL/well) can bind recombinant Human IL22BP, the EC50 of Human IL22BP is 10.78 ng/mL. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.