« Back
Home /
HCLS1 Recombinant Protein

HCLS1 Recombinant Protein

Item no.	PRS-92-435-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Dry ice	Yes
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Hematopoietic lineage cell-specific protein, Hematopoietic cell-specific LYN substrate 1, LckBP1, p75
Available
Applications	This recombinant protein can be used for biological assays. For research use only.
Applications	This recombinant protein can be used for biological assays. For research use only.
Buffer	Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Storage Conditions	Store at -20˚ C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight	55 kD
Purity	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background	Hematopoietic lineage cell-specific protein (HCLS1) is a protein that in humans is encoded by the HCLS1 gene. It is expressed only in tissues and cells of hematopoietic origin. It is substrate of the antigen receptor-coupled tyrosine kinase and plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. It may also be involved in the regulation of gene expression.
Accession #	P14317
Ncbi Gene Id #	3059
Ncbi Official Symbol	HCLS1
Ncbi Official Full Name	hematopoietic cell-specific Lyn substrate 1
Ncbi Organism	Homo sapiens
Swissprot #	P14317
Fusion Tag	C-6 His tag
Sequence	Met1-Glu486
Protein Gi#	524552373
Peptide Sequence	MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAVDHHHHHHGAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 9/6/2024

Express Delivery: Save 11 days

Compare

Add to wishlist

Recommend by mail