« Back
Home /
MFAP4 Recombinant Protein

MFAP4 Recombinant Protein

Item no.	PRS-92-386-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Microfibril-associated glycoprotein 4
Available
Applications	This recombinant protein can be used for biological assays. For research use only.
Applications	This recombinant protein can be used for biological assays. For research use only.
Buffer	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
Storage Conditions	Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days. Aliquots of reconstituted samples are stable at -20˚ C for 3 months.
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight	27.5 kD
Purity	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background	Microfibril-associated glycoprotein 4(MFAP4) is a secreted protein and contains 1 fibrinogen C-terminal domain, similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in calcium-dependent cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region.
Accession #	P55083
Ncbi Gene Id #	4239
Ncbi Official Symbol	MFAP4
Ncbi Official Full Name	microfibrillar associated protein 4
Ncbi Organism	Homo sapiens
Swissprot #	P55083
Fusion Tag	C-6 His tag
Sequence	Val22-Ala255
Peptide Sequence	VSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGVGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRAVDHHHHHH

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 10/4/2024

Express Delivery: Save 7 days

Compare

Add to wishlist

Recommend by mail