« Back
Home /
Parvulin-14 Recombinant Protein

Parvulin-14 Recombinant Protein

Item no.	PRS-92-173-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Dry ice	Yes
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4, Parvulin-14, Parvulin-17, Peptidyl-prolyl cis-trans isomerase Pin4, Peptidyl-prolyl cis/trans isomerase EPVH, Rotamase Pin4, PIN4
Available
Applications	This recombinant protein can be used for biological assays. For research use only.
Applications	This recombinant protein can be used for biological assays. For research use only.
Buffer	Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Storage Conditions	Store at -20˚ C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight	18.8 kD
Purity	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4(PIN4) is a peptidyl-prolyl cis/trans isomerase (PPIase) which interacts with NIMA and is vital for cell cycle regulation. PIN4 has 2 different isoforms: PAR14 and PAR17. Furthermore, PIN4 protein binds to double-stranded DNA under physiological salt conditions. PIN4 is involved as a ribosomal RNA processing factor in ribosome biogenesis. The PAR14 binds to tightly bent AT-rich stretches of double-stranded DNA, but PAR17 binds to double-stranded DNA.
Accession #	Q9Y237-2
Ncbi Gene Id #	5303
Ncbi Official Symbol	PIN4
Ncbi Official Full Name	peptidylprolyl cis/trans isomerase, NIMA-interacting 4
Ncbi Organism	Homo sapiens
Swissprot #	Q9Y237-2
Fusion Tag	N-6 His tag
Sequence	Met1-Lys156
Peptide Sequence	MGSSHHHHHHSSGLVPRGSHMPMAGLLKGLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 9/6/2024

Express Delivery: Save 21 days

Compare

Add to wishlist

Recommend by mail