Item no. |
PRS-91-357-0.05mg |
Manufacturer |
ProSci
|
Amount |
0.05 mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Lyophilized |
Specific against |
other |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Tissue Factor Pathway Inhibitor 2, TFPI-2, Placental Protein 5, PP5, TFPI2, REF-1 |
Available |
|
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Buffer |
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. |
Storage Conditions |
Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days. Aliquots of reconstituted samples are stable at -20˚ C for 3 months. |
Disclaimer |
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures. |
Predicted Molecular Weight |
22.88 kD |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Background |
Human Tissue Factor Pathway Inhibitor 2 (TFPI2) has a N-terminal acidic region, three Kunita domains separated with by two linker regions, and a C-terminal basic region. TFPI2 has the function of regulating plasmin-mediated matrix remodeling, inhibits trypsin, plasmin, factor Vlla/tissue factor and weakly factor Xa.. TFPI2 has no effect on thrombin. TFPI2 may contribute to tumor progression in many cancers; in these cancers, the expression of TFPI2 can be down-regulated. |
Accession # |
P48307 |
Ncbi Gene Id # |
7980 |
Ncbi Official Symbol |
TFPI2 |
Ncbi Official Full Name |
tissue factor pathway inhibitor 2 |
Ncbi Organism |
Homo sapiens |
Swissprot # |
P48307 |
Fusion Tag |
C-6 His tag |
Sequence |
Asp23-Lys213 |
Peptide Sequence |
DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKVDHHHHHH |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.