« Back
Home /
TFPI-2 Recombinant Protein

TFPI-2 Recombinant Protein

Item no.	PRS-91-357-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tissue Factor Pathway Inhibitor 2, TFPI-2, Placental Protein 5, PP5, TFPI2, REF-1
Available
Applications	This recombinant protein can be used for biological assays. For research use only.
Applications	This recombinant protein can be used for biological assays. For research use only.
Buffer	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
Storage Conditions	Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days. Aliquots of reconstituted samples are stable at -20˚ C for 3 months.
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight	22.88 kD
Purity	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background	Human Tissue Factor Pathway Inhibitor 2 (TFPI2) has a N-terminal acidic region, three Kunita domains separated with by two linker regions, and a C-terminal basic region. TFPI2 has the function of regulating plasmin-mediated matrix remodeling, inhibits trypsin, plasmin, factor Vlla/tissue factor and weakly factor Xa.. TFPI2 has no effect on thrombin. TFPI2 may contribute to tumor progression in many cancers; in these cancers, the expression of TFPI2 can be down-regulated.
Accession #	P48307
Ncbi Gene Id #	7980
Ncbi Official Symbol	TFPI2
Ncbi Official Full Name	tissue factor pathway inhibitor 2
Ncbi Organism	Homo sapiens
Swissprot #	P48307
Fusion Tag	C-6 His tag
Sequence	Asp23-Lys213
Peptide Sequence	DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKVDHHHHHH

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 10/4/2024

Express Delivery: Save 10 days

Compare

Add to wishlist

Recommend by mail